SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_666078.1.74355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_666078.1.74355
Domain Number 1 Region: 146-197
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000536
Family Tudor domain 0.012
Further Details:      
 
Weak hits

Sequence:  XP_666078.1.74355
Domain Number - Region: 9-61
Classification Level Classification E-value
Superfamily STAT 0.000824
Family STAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_666078.1.74355
Sequence length 285
Comment hypothetical protein [Cryptosporidium hominis TU502]; AA=GCF_000006425.1; RF=representative genome; TAX=237895; STAX=237895; NAME=Cryptosporidium hominis; strain=TU502; AL=Scaffold; RT=Major
Sequence
MTRVNSKLMEIFQETYEELLKIFENNREQLRKIDEQLLKLTTDDPNYDILKEVRDDLIQV
IQLVEELIDNKRKNSDENPEDVNIGKIVEVFYKGNKRFGRIKSKDLKLASNTINDYYLIS
IFGQIPETISLQFQDLKLLPQFKGLSVGEKVQVLFEEDGNWYNSVIVGLTKNGYNIKYLD
YNQEENVTYDRVRMISKSSRSNLNHDKTIDSLDSTSIITTPAGYKIPENLLIKSYDTEKT
KLEKKKKISVIKKQQKNEIFETQAKQKQQSWKNHISKFQKNSKII
Download sequence
Identical sequences A0A0S4TDG5
237895.Q5CGW6 XP_666078.1.74355 Chro.40041 gi|67596472|ref|XP_666078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]