SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_676166.1.11252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_676166.1.11252
Domain Number 1 Region: 2-239
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.92e-44
Family Duffy binding domain 0.00000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_676166.1.11252
Sequence length 600
Comment erythrocyte binding antigen 140 [Plasmodium berghei strain ANKA]; AA=GCF_000005395.1; RF=representative genome; TAX=5821; STAX=5821; NAME=Plasmodium berghei; AL=Scaffold; RT=Major
Sequence
MDYFKQFIYKDAAREGELLLNKYNEKNNNEYCNDMINSFGDYKNIVEGTGLNNVANSNLL
ELKIQNIFGANDNGKRDRRNWWKRHEHIIWKAMVLGTNFNENSNYNNICINYKLEDYHSQ
IERWTREWIQEFGVQYFKEAIKINNKCTKKSIISTESICINNACKDECNTYETWISVNKS
KWDALLQRFSEFNKNYFSEETCRDKAYNSLMIEFKEAYEVNFENVINLDDDHYTELCVCS
SARPSNTAINKSLDHKQTLESQNPTDASQNNLLPPSNTNTNHDLFKEDDDDNNGFDLLSY
SNTDAQNSRNSTATEQVSVNDEKNKLNQNAESNNKYELQIMGNHSNSDNTYHNIIIPPQE
NHIQNIHTSIPQSVTSNPTLNTNTNGNINGNTDGDTNSTLTPNLDLNPTQTLNPNATNIE
VKEHHFSTNGTENKNTKKEQMSTSQIKYNKDPKHDNIISGDVSRSNNDINSENANKLEIY
EYENRNVKKTRENIIMLANENVCNGNPGLKYCESINNKYFHGACPKSQTQNLCCSISNYC
IKFFNINSNNYYSCMNEEFMDPSYTCFQKGSYSNQYYYAAGGIIFVIIFIFASIGFSGNK
Download sequence
Identical sequences Q4Z1T1
gi|68068511|ref|XP_676166.1| XP_676166.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]