SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_676553.1.11252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_676553.1.11252
Domain Number 1 Region: 348-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000209
Family Merozoite surface protein 1 (MSP-1) 0.023
Further Details:      
 
Domain Number 2 Region: 301-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000392
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_676553.1.11252
Sequence length 409
Comment merozoite surface protein 8 [Plasmodium berghei strain ANKA]; AA=GCF_000005395.1; RF=representative genome; TAX=5821; STAX=5821; NAME=Plasmodium berghei; AL=Scaffold; RT=Major
Sequence
MKRSSQIIIFLLLSLVCKFSIGICKENGNGNINKSNNNRVIKKERKRKAKSNANKNEPEN
KEHEIINLYDDVQELLGNERMSMLDKYSILGIDDCSNESENNKIIGEYDLKAMKSVLLYK
NRISKVSLENLYDVKTVFKRCFNKDDPELSKSYEHLQDQAAIEGTTIIDYLSNYILNVYV
KMNDEFIKNDGFKLSKYIPELEIINYALYNGPKELENRIKSGLNEINNIIISESLTSIYS
SVVSGLNINCKIKDDLITILNLSDGKYFKVDFSSQATMIVPGQYSHEHGNMKKISEYFIE
KNRICKNEKCPINSNCYVIDNVETCRCIPGFSKNKESESLKCDIDESTSCENNNGGCDVN
ATCLLLEDKIMCECNNKYNGDGIYCSNAIYYGMNVFVFFLISIVCIYIM
Download sequence
Identical sequences A0A077XDA8 A0A0Y9XJ90 Q4YRN8
XP_676553.1.11252 PBANKA_110220 gi|68069285|ref|XP_676553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]