SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_677896.1.11252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_677896.1.11252
Domain Number - Region: 58-96,126-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000633
Family Glutathione S-transferase (GST), N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_677896.1.11252
Sequence length 162
Comment hypothetical protein [Plasmodium berghei strain ANKA]; AA=GCF_000005395.1; RF=representative genome; TAX=5821; STAX=5821; NAME=Plasmodium berghei; AL=Scaffold; RT=Major
Sequence
MRKIIFLIVIVLSFLGLIQNKGRTPNRNSKIKKLPVIKDSTKLISIIDKTPTKQYITYVY
HSSICSYCSLITDALKDNEHVKMIKINDDSKLEDLIKTDKPIVVILKNINKEDSVERSKF
YYELQKKGGKVRVPALEINNHIMYESKEILAFYKHLLSKFEN
Download sequence
Identical sequences Q4YAW0
gi|68071965|ref|XP_677896.1| XP_677896.1.11252 PBANKA_136450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]