SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_678479.1.11252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_678479.1.11252
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.44e-19
Family Staphylococcal nuclease 0.016
Further Details:      
 
Domain Number 2 Region: 594-642,678-763
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.4e-17
Family Staphylococcal nuclease 0.007
Further Details:      
 
Domain Number 3 Region: 811-907
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000384
Family Tudor domain 0.0053
Further Details:      
 
Domain Number 4 Region: 362-446,516-565
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000000222
Family Staphylococcal nuclease 0.0089
Further Details:      
 
Domain Number 5 Region: 859-1008
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000157
Family Staphylococcal nuclease 0.0029
Further Details:      
 
Domain Number 6 Region: 164-186,235-352
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000275
Family Staphylococcal nuclease 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_678479.1.11252
Sequence length 1012
Comment hypothetical protein [Plasmodium berghei strain ANKA]; AA=GCF_000005395.1; RF=representative genome; TAX=5821; STAX=5821; NAME=Plasmodium berghei; AL=Scaffold; RT=Major
Sequence
MERLIGVVKQVISADTYVLLGPKKNGIAQERQVSLACIQCPKLYVKSQTLEKNEEPFAWE
SRELIRKMIIGKNVSFTLEYVYNNRQYCSVYFETNLSILLLEKGYANLVFNKNVKTNVYA
DLEPYYLEAQNKNLGIFGNNINNFVRNIININNDKNENKKIYDTLVNKKVHCVIEHVRDG
GHLRVYAQLEKNENKDEGNKKNNVKNESKKNGKGGKGAKKKHEDNTINQTGEKYLTMYYF
SISLCGIIVDMYKKEVINNVETIKEETYATETKKFVEYRLLNRDVEIEIKHIDNNLNLYG
NIYYKLGNICLLLLKNGYAYINDYTIKYVENPLEYKKALDEAVKLRKKKWINYSEKEVDF
EKEYITTVIEVLYGDIIIVDYKNEERRLYLSSIKCEKHNSDIHLNTLSLLAKDYLKKKIV
GEQVKIVTECVKTPQSNNEGYIPPCSDNKGRMHFVSVYQIKKKQVDKKGNVPISNKINSE
IADKDNSGKKKKGKKSNNNTKDDKKNESENMDQENYNEISLNEELVAEGLAKVVNYVQEN
EKPNYYFNLQALEKESEKKKLGRFNPHLDIIKINNISGSENALRARSFENTLNKYNNLNA
YVDYIYGANKYKIYIPSQNLMINFILLGVNIQKINLKEIGNENVNKNGNIENAKREDDYV
VGDAGKKNKKKEKSEYKDIAIQAYKYVRKLLMQRAVQICIITCDKGGNFIGTLKYQNKDI
AQHLLSLGYGMLNDIGLKNITERSNYIKATEEAKNNKRNIWAIEIVNENTENSPINGDKA
KLSEFDNIYYCSYVDDINNICLQLKNKQDQLKKFQEDINKKSYIESIPEISINNINKNTL
VLAKYIDNYYYRAVILQINKSKNKCIVKYIDFGNEDEISFADIKKLTPEYSLKNYHQFAI
KVALSGLKMPEDNKPDLMIYIKQLLLDKFLYVKFEKKTENIYHVVFYDYEQFTTNKNVKS
VNEEMANQGICYVDNFSDTKIFEKLKKEELQSKKNKLGIWSYGDINYDDNYA
Download sequence
Identical sequences Q4YSM6
XP_678479.1.11252 gi|68073129|ref|XP_678479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]