SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_688092.3.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_688092.3.45394
Domain Number 1 Region: 144-275
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.34e-44
Family Synaptotagmin-like (S variant) 0.00000539
Further Details:      
 
Domain Number 2 Region: 282-417
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-43
Family Synaptotagmin-like (S variant) 0.00000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_688092.3.45394
Sequence length 433
Comment synaptotagmin-2-like isoform X2 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MKWNLFKKKPEAMVGPEPTGPGGTHPSHTMTMAPAVSTPADNSTESEGTVNKNDVFEEIK
SKFLNEIDKIPLPPWALIAIAVVAALLILTCCFCIIKKCCCKKKKNKKGKKGKDGFNMKN
MQGGDDDDDEEGETGLTEEEKEEEEKEVEKLGKLQYSLDYDFQDNKLTVGILQCADLISM
DSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNESFVFKIPYQELGGKTLVMSVYDY
DRFSKHDIIGEVKLPMNTLDLGQPIEEWRDLDSAEKEEPEKLGDICISLRYVPTAGKLTV
CILEAKNLKKMDVGGLSDPYVKIQLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQ
MQKIIVVVTVFDYDKIGKNDAIGKIFIGSKASGTSQKHWSDMLANPRRPIAQWHPLQQEE
DIDAALAALNAKK
Download sequence
Identical sequences XP_688092.3.45394 ENSDARP00000016769 ENSDARP00000016769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]