SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_699900.6.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_699900.6.45394
Domain Number 1 Region: 231-495
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.18e-83
Family Nuclear receptor ligand-binding domain 0.00000000153
Further Details:      
 
Domain Number 2 Region: 126-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-26
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_699900.6.45394
Sequence length 496
Comment peroxisome proliferator-activated receptor delta [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSVCEMDRRHVLALRSRLPRNLGSVGGVYMDPGDSSPCSSQGEGPDDQRLQDVLCELGEG
AGLNLELESEGGVALQGEELSWETSRQEEQSNTSSTSPDRSSASTDLSTALSEQLLRGRE
EVSGINMECRICGDRASGFHYGVHACEGCKGFFRRTIRMKLEYERCERSCKIQKKSRNKC
QFCRFQKCLMLGMSHDAIRYGRMPEAEKRKLVAGLLAGERGSQNSNESDLKTLAKRVNNA
YLKNLNMTKKKARNILTGKTSASTPFVIHDMDSLVQAENGLVWNQVIHGAPPNKEIGVHV
FYRCQCTTVETVRELTEFSKSIPGFIDLFLNDQVTLLKYGVHEAIFAMLPSLMNKDGLLV
ANGRGFVTREFLRSLRKPFSEIMEPKFEFAVKFNALELDDSDLALFVAAIILCGDRPGLM
NVHQVEKIQDSILQALNQHLQLNHPDGRFIFPRLLQKLADLRQLVTENAQLVQKIKKTES
ETSLHPLLQEIYRDMY
Download sequence
Identical sequences F1QJT0
XP_699900.6.45394 ENSDARP00000109331 ENSDARP00000109331 ENSDARP00000124414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]