SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_710086.2.88832 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_710086.2.88832
Domain Number 1 Region: 133-153,204-306
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000181
Family UAS domain 0.034
Further Details:      
 
Domain Number 2 Region: 436-477,514-526
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000904
Family UBX domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_710086.2.88832
Sequence length 568
Comment hypothetical protein CAALFM_C403920WA [Candida albicans SC5314]; AA=GCF_000182965.3; RF=representative genome; TAX=237561; STAX=5476; NAME=Candida albicans SC5314; strain=SC5314; AL=Chromosome; RT=Major
Sequence
MSSSISDWIRNFFQPSTSYQRVGTSSNSSIPGSFPTEQESNSPPHPPSSRISPVFNSQTI
NSTFRNLSSWLNYLLIQPLIIIILVIFRILSTIINVIYFQNQSPSIVNGSGGGGGSGSGI
DGSTNNNSRCEFVDPVAKASKFIRDLEDNLQPPSILQGNDINSGGGGSNDTHSPITSATR
PVSGTTVTTTTTTTSTTISNSERLPPFFQGSYTQALYMATKRGKFLFVYLTNPHNENANG
IFNNIITNEIFLKIFRTNENIIIWGGDLTNPEAYQLANSLAVTKFPFLGLLCLTRSSKMT
PEGPRKTVSKLSLVSKIQGNIINTQSLSLGLHQYQNQYQDTNFDDGNLSVANELINRKFL
TKIAKYSPELNLIRQELQDKYMSQILLKQQELNYQKSLQADKLKKQKKQYDTLSKQYLIY
QLDRFEKYLTKDRVANDNIAKIAIKLTNGNRVTGYFPSNNSIDDIFIFVELINRGYLNVA
NNSTTTTTTTTTTKLTSTLTESQALTKFKDFKLIYNFKLLSPLPPKICLNDVLSSSKDTT
PTATTIKINQFDIIYPNGLLIVEDIQKD
Download sequence
Identical sequences A0A1D8PLX6
XP_710086.2.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]