SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_719372.1.88832 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_719372.1.88832
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.06e-36
Family Thioltransferase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_719372.1.88832
Sequence length 103
Comment thioredoxin [Candida albicans SC5314]; AA=GCF_000182965.3; RF=representative genome; TAX=237561; STAX=5476; NAME=Candida albicans SC5314; strain=SC5314; AL=Chromosome; RT=Major
Sequence
MVHVVTEVNEFQTLLKENNLVIVDFFATWCGPCKMIAPLLEKFQNEYSNIKFLKIDVDQL
GSLAQEYNVSSMPTLILFKNGEEVNRVIGANPAAIKQALASLA
Download sequence
Identical sequences A0A1D8PU69 C4YN54
CAWT_02294 XP_719372.1.88832 5476.CAL0000819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]