SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_721341.1.88832 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_721341.1.88832
Domain Number - Region: 58-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0125
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_721341.1.88832
Sequence length 153
Comment mitochondrial 54S ribosomal protein MRP49 [Candida albicans SC5314]; AA=GCF_000182965.3; RF=representative genome; TAX=237561; STAX=5476; NAME=Candida albicans SC5314; strain=SC5314; AL=Chromosome; RT=Major
Sequence
MSTRMFITSKNKYNKKIENAIKKINKLTANPETSFKFDAERFKEIELFVYGQRPITYKPA
WGLKLFWKDNLPTLRYHNPDIQFTVNNITVESESELSKLPLKLKVHGTDQSNSFEINCTD
KPPSKILSELIEITKARKLTEEELPKLPLRPVK
Download sequence
Identical sequences C4YTR7 G1UAT6 Q5AH35
XP_721341.1.88832 CA4968 CAWT_05562 5476.CAL0003032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]