SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_721347.1.88832 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_721347.1.88832
Domain Number 1 Region: 63-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 2e-30
Family Thioltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_721347.1.88832
Sequence length 156
Comment hypothetical protein CAALFM_C702080WA [Candida albicans SC5314]; AA=GCF_000182965.3; RF=representative genome; TAX=237561; STAX=5476; NAME=Candida albicans SC5314; strain=SC5314; AL=Chromosome; RT=Major
Sequence
MDYFQTEKTTETRQQRQQKKRPVRNSIICTLSLSYQPNFVMSSLIGWLSSWFQNEPITPE
LKKEIESNINSHKVLVYSKSYCPYCTSTKTLLQSLNQDYKVIELDQIPKGSAIQNGLQEL
TGQRTVPNVFINGKHIGGNSDIQALHSQGKLKPLFG
Download sequence
Identical sequences C4YTR3 G1UAU6 Q5AH29
CA4964 XP_721347.1.88832 5476.CAL0003046 CAWT_05558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]