SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_721348.2.88832 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_721348.2.88832
Domain Number 1 Region: 23-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.69e-27
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_721348.2.88832
Sequence length 123
Comment Grx1p [Candida albicans SC5314]; AA=GCF_000182965.3; RF=representative genome; TAX=237561; STAX=5476; NAME=Candida albicans SC5314; strain=SC5314; AL=Chromosome; RT=Major
Sequence
MSSILAWGFNLWYQPPPPTAQTEKEIEHTINSHKIVIYSKTYCPFCDQTKHLLNEQYPQE
SYEVINLNILDDGLTIQNQLYANTGQYMVPIIFINGQHVGGNSEVQQLHTNGKLQELLNP
QKY
Download sequence
Identical sequences A0A1D8PR08 C4YTR2
XP_721348.2.88832 CAWT_05557 CA4963 5476.CAL0003068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]