SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_723703.1.76580 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_723703.1.76580
Domain Number 1 Region: 168-213
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000241
Family Tudor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_723703.1.76580
Sequence length 321
Comment hypothetical protein [Plasmodium yoelii yoelii 17XNL]; AA=GCF_000003085.2; RF=representative genome; TAX=73239; STAX=5861; NAME=Plasmodium yoelii yoelii; AL=Contig; RT=Major
Sequence
MDEFNESLEDLEEKINEYNKQLALVRDEIKKYEQIQNDQNEENEQIQNLKKLECDMIEVI
NLTRDLIKYKKKNESDDEIPNQIAEENEQPFSNENENVMNESELLVGRTCSFMYENKRVY
GSIENVVIQNNMEQLLVHVFETNEQVLVQKNYVQLNEILHTLPTSENNQFQALYKKDGQW
YDCMVSKNKGDSYLITYIGYNNSEYVKNDQIRIKKKKKIKEVITPAGYKIPENLIIKEND
SLKTKLKKTKKRNALKKKQKNELINKEFANKTQQWKSVHEKAISKSKHLLIAHKKTENIE
YTNNPANINIRRKFDYKDNED
Download sequence
Identical sequences A0A078KAD7 Q7RSJ7
73239.Q7RSJ7 gi|68532056|ref|XP_723703.1| XP_723703.1.76580 103.m00098|PY00358|PY00358|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]