SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_726293.1.76580 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_726293.1.76580
Domain Number 1 Region: 79-217
Classification Level Classification E-value
Superfamily MTH1598-like 1.12e-45
Family MTH1598-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_726293.1.76580
Sequence length 217
Comment hypothetical protein [Plasmodium yoelii yoelii 17XNL]; AA=GCF_000003085.2; RF=representative genome; TAX=73239; STAX=5861; NAME=Plasmodium yoelii yoelii; AL=Contig; RT=Major
Sequence
MGDFPNNQITSLPQRNRRRINRNYAHEESKSTCTNEIEENEATNDENVDKNADKNANKNA
DKNMMSDIEICNINLNKNYKYEYLDHTADIILHSYGNNLKEAFESVCVALFNYMCDLKNV
ELKMKRKISIKGDDLDDLLFKFLVEFHFLYGNEYFICKTINIIVFDIEQFYIEAYGYGEL
FSTYKHECGTEIKAITKHELKIVSNYNSCEVFVLVDI
Download sequence
Identical sequences A0A077YEV0 Q7RRN2
73239.Q7RRN2 189.m00113|PY00687|PY00687|Drosophila XP_726293.1.76580 gi|82596517|ref|XP_726293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]