SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_726594.1.76580 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_726594.1.76580
Domain Number 1 Region: 366-463
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 4.25e-16
Family Cdc48 domain 2-like 0.0022
Further Details:      
 
Domain Number 2 Region: 581-626
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000106
Family RING finger domain, C3HC4 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_726594.1.76580
Sequence length 628
Comment hypothetical protein [Plasmodium yoelii yoelii 17XNL]; AA=GCF_000003085.2; RF=representative genome; TAX=73239; STAX=5861; NAME=Plasmodium yoelii yoelii; AL=Contig; RT=Major
Sequence
MERKSGKSKYMHFLPIINSQRKLNILEKNNVLEKIHILPIKKKSSNYHELYNKLNKLINE
KSILYEGIVISLKDGSEHSDLKLSKIPHINEKEESIKIKNKINNDDVFGIDKISTDESSS
DENQTCDVDLPLNDNNNDNXDNNDDNDDNDNNDDNDNNDENEKMSELIVNNVDYVIINCI
PSKGVLNHDTLIYTDGKYVDYLKKIEIIIINDKHYKKYEKNIKRKFISFKKMLLKKSNDF
FNGAMSLFPLYFNFIPELCMSKNRNKVSKNEQCSIERIPNLGTCDECDTNKTNKTNRTNQ
INNIITQKFLTTHLIPYFKNNRNKLFYPGKLFNVNNFSFLVSKIDVDISAGFIDDLTEIN
LRFDSYEEYTHVHIVPLYDTLPTTYNYNLFIDYIKPYIERHYLNTFSIYDTFFYRGVQFK
IMGVEPINMKCGKGRISANTSIYIQGSVKPTFFDVISNKSFNYIKSLPFEYKPYAILNIL
QHLDTDSLLRLFPSANINMESSTKNEQTILHSLAPLMYIYNKENISYASNRGDSSRSDSS
RIDSNGGNSSRSDSNGGNSKDVIIEQSNGHSELNNNIINEQCVVCFEHFINDDKCIKLTC
LHTYHWKCVQNWFRFNLTCPCCRHKLNI
Download sequence
Identical sequences Q7RTI8
XP_726594.1.76580 gi|82704534|ref|XP_726594.1| 73239.Q7RTI8 2.m00102|PY00003|PY00003|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]