SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_774677.1.65578 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_774677.1.65578
Domain Number 1 Region: 195-282
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.83e-21
Family Elongation factor TFIIS domain 2 0.0018
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3.79e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00092
Further Details:      
 
Domain Number 3 Region: 303-338
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000794
Family Transcriptional factor domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_774677.1.65578
Sequence length 349
Comment hypothetical protein CNBF3560 [Cryptococcus neoformans var. neoformans B-3501A]; AA=GCF_000149385.1; RF=na; TAX=283643; STAX=5207; NAME=Cryptococcus neoformans var. neoformans B-3501A; strain=B-3501A; AL=Chromosome; RT=Major
Sequence
MDATTLTGHVKELNAANQAGKSDEVISLLKKLQAEVVPTEDLLRSSKAGVAVGKLRTHAT
PSVSSLAKEIVKKWRDAVEETKKKRKRAEGDEGKDVKKEKEEGNGKRVKAESMCALSPAA
ESGSDTHIHFAAGSLAATPSASTPASASTPDVKATSPPVRQPLSTIDSSRTTPRTAKSDG
VADSLRADSSEGGSVDSVRDKCVIMIYDALALDSTAERAIGIERAANKAMNFSTGNDYRA
KMRSLFLNLKDKGNPALRNEIVLGYVSTEKVASMSKDEMASESVRMLKEKIASDNLFKAK
AVGVTQAETDAFKCGRCHQRKCTYYQMQTRSADEPMTVSRYLAHMIRWY
Download sequence
Identical sequences F5HGK5
XP_571548.1.95466 XP_774677.1.65578 sgtc|cn06360 214684.CNF01160 180.m00295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]