SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_809654.1.87722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_809654.1.87722
Domain Number 1 Region: 43-784
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.61e-201
Family Motor proteins 0.0000000168
Further Details:      
 
Domain Number 2 Region: 958-1007
Classification Level Classification E-value
Superfamily UBA-like 0.00000000373
Family UBA domain 0.022
Further Details:      
 
Weak hits

Sequence:  XP_809654.1.87722
Domain Number - Region: 1011-1054
Classification Level Classification E-value
Superfamily UBA-like 0.000533
Family UBA domain 0.03
Further Details:      
 
Domain Number - Region: 18-58
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0165
Family Tudor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_809654.1.87722
Sequence length 1058
Comment myosin heavy chain [Trypanosoma cruzi strain CL Brener]; AA=GCF_000209065.1; RF=representative genome; TAX=5693; STAX=5693; NAME=Trypanosoma cruzi; strain=CL Brener; AL=Scaffold; RT=Major
Sequence
MNEPAIERVAVQQQVYYYLPQKGWLRGVVATVLDGEKKAHVVNATTGNKETVPLSQIHGY
MDQAFDPSDPDLFHLSDLHVATTLYCIKERFVQLKQQYSLMGEMLISVNPFRLMPFNSDA
HREKYLNSAQNHLLPPHIWQVAHRAYSQIVIRGFDNQSVVISGESGSGKTENTKMLIYYL
GELSHMHSSNAMQKSVADKVANCLKWSNPLLESFGNARTVRNDNSSRFGKYIKLYFDPSS
GVMVGGQTVTYLLEKSRLLLQSVGERNYHIFYEMLAGLSPEEKKELGDLKSAQEYKCLSG
GNTFVRRGVDGKTLDDSLEFQNVLHALTALDVEADVQRSIFKVLASILHLLELRFKSDQN
DMACFEDEAPFLTACSLLQLDPALLRECFLVKSHTSLVTIYANKTEAEGFCGAFCKAIYV
GLFDRLVDFVNQSIDAHGEVSRCKYIGLLDIFGFEKFTRNSFEQLCINYANEALQNHYNK
YTFLNDEAECEAEGIEVPKIVFPDNSECVQMLDQKKIGVFSMLDEECHFKGGTVERFTHN
LWDQWANKSKYFVLPKSTVPNQFGVNHYAAFVNYNTDEWLEKNTDRVKEEAYQCILNSGD
PFIRTLTPKDSLLDKRKQTVALRFQEQLAALREELESTETQFIRCIKPNMEASPDTLDNC
LVGNQLESAGVLQTIALKRQGYPMRRTIEQFCRYFFLIMPRSAIRLFKQNKLKAAAKDFL
AYYQKLYGWQKPHYAVGHTKVFVRAEVWSSVERLLLRRKAWLLRRCVPFLLRWVYTNREQ
KRLAEERRKEELRKAKEERERLIAEINARGFSLEQMEWVEELATLFSSVDVSTLIDIVAI
LPKREESLATLTEMQQQRVDGSLPSTFMRVMSESEVRPSVVQALVEGGVATMAGLSQCDQ
AQMKQFGMTDAEVAAVTRTILKEQSARVKLERLQSSIGTAQLEKVVGEVKRRVMTQSDFA
TKVEKLVRMGFPRSHAELTLTHYNGDVQKAAERLLHGGVEKHLHEEPPHGSKGRWTSLDP
EVQRLVKLGVPKGAAKRVLRQTSGNVDEAVRLVFPPVS
Download sequence
Identical sequences Q4D5J9
psu|Tc00.1047053511527.70 gi|71415156|ref|XP_809654.1| XP_809654.1.87722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]