SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_812722.1.87722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_812722.1.87722
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.73e-17
Family PWWP domain 0.011
Further Details:      
 
Domain Number 2 Region: 243-333
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000000000876
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0057
Further Details:      
 
Domain Number 3 Region: 466-515
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000553
Family Transcriptional factor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_812722.1.87722
Sequence length 518
Comment hypothetical protein [Trypanosoma cruzi strain CL Brener]; AA=GCF_000209065.1; RF=representative genome; TAX=5693; STAX=5693; NAME=Trypanosoma cruzi; strain=CL Brener; AL=Scaffold; RT=Major
Sequence
MAFPLNTLVWLKQPGYPWWPGMVLDPAALEMVLPAGYDTCVLCLPSVSSSVAFANSSNAE
ELLRFDPETDAELIEAGKQDADCAAAIEEALNVYEQQAQQAQLEEEEGEKNEHEDGGGRK
GTHTRKKHMPHKADKHERKRRKRHERNESTPVDRRYRHEKKKNERRKYMDSDDLESGTTE
DLSDNSDDRRRGKRTGKKSGKAGSQDAVDQYEEEAGFLPTHQEDDAAYLERMLRENRHTV
SDSTLATIRHKLETLTEACNHGGVISVSEAAEEELLEVLSPLSLVNVTLDQLRRLKIGVT
VGKFLLRDYPVRVVSLASAILTYWFRQLPPATQQLLSKKSALDMASNDTTIGSERQDVSL
GALGVQLEACFTDEEVCDTINDPVIVAGNIEKELEAVDDEDVSMEVLAALRDGSNTALRC
GLLDGSITAKDFVANPTNPDLLLKRSDNDGDKTSGVSPVEPESPLEEGSDLTNFTTLYVC
PGCGAREAVANEYSVQAHDNMAVFVRCLKCDETWNVEA
Download sequence
Identical sequences Q4DEC5
XP_812722.1.87722 gi|71424224|ref|XP_812722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]