SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_847603.1.54365 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_847603.1.54365
Domain Number 1 Region: 635-703
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000353
Family Collagen-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_847603.1.54365
Sequence length 899
Comment hypothetical protein [Trypanosoma brucei brucei TREU927]; AA=GCF_000002445.1; RF=na; TAX=185431; STAX=5691; NAME=Trypanosoma brucei brucei TREU927; strain=927/4 GUTat10.1; AL=Chromosome; RT=Major
Sequence
MGAAPSRETLRRGLYNVPTQMKNNVDSSRSQSKPDIVLIPLIKEYFPSADCPLFVQFHKM
RCDPGVNYYFRHPLYPGDLSRIPNVHSNDARSSNRSRDALYSEFVEQTEERLFDTDNEMR
QAHELSMSDRSAGGSPSFHMEGAKTANVGKKVLPIICAVAFLHDREKFEQLQQTQGTPGG
SRVPHVLMGKENSDILEGKVVNIIGFFGMLPREIERKPLTSPVIFSPVSPGLSATGKGIA
APSMLKNSLSLPCTARGPSHGSSQDLQQLIAPLSSQASVASGNELRNRPSFVPTPHVPPE
RCPLTASAGAFSLVSSLGGTPAREPSARQRPFLQSEGLLREMDQALSYRCTALEERLSRF
GLPAPAAPEPLTAVVFMTKSAGEQNLCRVTFVAAKTYHGQLVEAGVLKQRGNGPSPPLES
ERRYLPPLETFSFSSLMTNVPFISFVYEMRCRWGRFGFFSRRVDSPSLRMGSLNASSSFT
YGFTGGAHSEAPNPEETHRGFAMWLTKNGVFHGRIERELAEHLCFCMAEQPDFMSVPAAT
LPIGGGYWRFRGLVDRNNPRPIQLCGDGAEAADPLDVYVMGSPAVGGFDEGDVLKYDQTS
RSWVANRDIPLDAVVLAAMRPFCKAARTAPPDDIGWVTIEVEEQDEMGVEDQDHLETAGK
RDMDTGAVVRQEDRDGTVVRKRVHVREGNFYIYRFELNGEVHYHGTVPDFANPNKKRASH
SSSVGARSVAPMGPAVVARRFDNTNERGRQHSVGLTADRSTNEHSLSVTSTFSPPFVESF
MGSERTSATFLASPLQPVREAISRSVGTVSYSNRGYESTGSQSSFPVVPVTPDTMFPPSR
GLTTPVARRRSTFVPVGSEVEVDESQRDTNESDGGPTAFVRRFIDSTVYIWDWRYCADR
Download sequence
Identical sequences A0A1G4IBE6 Q57U67
XP_847603.1.54365 5691.Tb927.8.7760 Tb927.8.7760 gi|72393605|ref|XP_847603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]