SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_848875.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_848875.1.84170
Domain Number 1 Region: 46-320
Classification Level Classification E-value
Superfamily L domain-like 7.6e-56
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 242-480
Classification Level Classification E-value
Superfamily L domain-like 5.27e-43
Family Ngr ectodomain-like 0.0045
Further Details:      
 
Domain Number 3 Region: 545-844
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.39e-28
Family Rhodopsin-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_848875.1.84170
Sequence length 965
Comment PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 6 isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MRSPAGLGALWLCAALCASPPAGAPQPRAAPACPAPCRCQEDGIMLSADCSELGLSAVPR
DLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGHAFSGLYSLKILMLQ
NNQLGGVPADALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRAL
NNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLN
YNELQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQCVGRSAFQ
DLPKLHTLSLNGATDIQEFPDLKGTTSLEILTLTRAGIRLLPPGMCQQLPRLRVLELSHN
QIEELPSLHRCQKLEEIGLQHNRIGAIGADTFSQLSSLRALDLSWNAIRSIHPEAFVTLR
SLVKLDLTDNQLSTLPLAGLGGLMHLKLRGNLALSQAFSKDSFPKLRILEVPYAYQCCAY
GVCAGFFKSSGQWGAEDFHPAEDEAPKRPPGLLAGQAENHYDLDLDELQLDTEDTRPRPS
VQCSPAPGPFKPCEHLFESWGVRLAVWAIVLLSVLCNGLLLLSVFAGGPGPLPPVKFVVG
AIAGANAVSGLSCGLLASVDALTFGQFAQYGARWETGLGCRATGFLAVLGSEASVLLLTL
AAVQCSVAVSCIRAYGKAPALSSVRAGALGCLLLAGLAAALPLTSVGEYGASPLCLPYAP
PEGRPAALGFAVALVMMNCLCFLLVAAAYIKLYCDLPRADLEAVWDCAMVRHVAWLIFAD
GLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRRLW
PCAGTPGPLAYAAASELEKSSCDSTQALVAFSDVDLILDTSEAGRPPGLEPYGFPSVTLL
SGQQPGGPRSEGSHFAEPEGAHFGSPPASVDGELRLRAEGATPAGGGSSAGRALQPAGPA
FASHL
Download sequence
Identical sequences E2RGS8
ENSCAFP00000015480 XP_848875.1.84170 9615.ENSCAFP00000015480 ENSCAFP00000015480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]