SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_851594.3.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_851594.3.84170
Domain Number 1 Region: 14-301
Classification Level Classification E-value
Superfamily Ras GEF 4.58e-80
Family Ras GEF 0.0000351
Further Details:      
 
Domain Number 2 Region: 454-578
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_851594.3.84170
Sequence length 585
Comment PREDICTED: ras-specific guanine nucleotide-releasing factor RalGPS1 isoform X5 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVSPEEFASQITL
MDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAE
ILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSK
EDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRII
ADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKE
DLAGPSTGSSSARFSRRPTCPDASVAGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSAT
FPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLESRGRL
YATLGPNWRVPVRNSPRTRSCVYSPTGPCICTLGSSAAVPTMEGPLRRKTLLKEGRRPAL
SSWTRYWVILSGSTLLYYGAKSLRGTDRKHYKSTPGKKVSVVGWMVQLPDDPEHPDIFQL
NNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQVPANLMSFE
Download sequence
Identical sequences J9P7P9
XP_851594.3.84170 ENSCAFP00000029901 ENSCAFP00000041688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]