SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_852038.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_852038.1.84170
Domain Number 1 Region: 264-364
Classification Level Classification E-value
Superfamily SH2 domain 1.31e-27
Family SH2 domain 0.00034
Further Details:      
 
Domain Number 2 Region: 188-290
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-22
Family SH3-domain 0.0000774
Further Details:      
 
Domain Number 3 Region: 111-168
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 4 Region: 5-61
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_852038.1.84170
Sequence length 377
Comment PREDICTED: cytoplasmic protein NCK1 isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKHSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLIKHLS
Download sequence
Identical sequences E2RHV6
ENSCAFP00000011072 XP_004414922.1.74151 XP_004414923.1.74151 XP_005634524.1.84170 XP_005634525.1.84170 XP_005634526.1.84170 XP_005634527.1.84170 XP_012422965.1.74151 XP_021534435.1.83697 XP_852038.1.84170 9615.ENSCAFP00000011072 ENSCAFP00000011072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]