SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_853426.2.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_853426.2.84170
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.92e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.0016
Further Details:      
 
Domain Number 2 Region: 251-361
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-20
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 
Domain Number 3 Region: 132-231
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-18
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_853426.2.84170
Sequence length 381
Comment PREDICTED: arf-GAP with dual PH domain-containing protein 2 isoform X3 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MGDRERNKKRLLELLQAAGTGNAHCADCGAADPDWASYKLGIFICLNCSGVHRNFPDISK
VKSVRLDFWDDSTVEFMSHNGNLRVKAKYEARVPAFYYVPQANDCLVLKEQWIRAKYERQ
EFMADGKTMSSPGNREGFLWKRGRDNAQFLRRKFVLLAREGLLKYYTKEEGKGPKAVISI
KDLNATFETEKIGNPHGLQITYRREGHIRNLFVYHESGKEIVDWFNALRAARLQYLKTAF
PELPESELVPLITRNYLKQGFMEKTGPKQREPFKKRWFALDPQERRLLYYKNPLDAFEQG
QVFLGSNEQGYGVYEDLPKGIRGNRWKAGLTIITPERRFVFTCPSEKEQREWLESFRDVL
SRPLTPLNLLPASSESGHSSR
Download sequence
Identical sequences F1PZX4
ENSCAFP00000030645 ENSCAFP00000030645 XP_853426.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]