SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_853996.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_853996.1.84170
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000406
Family F-box domain 0.0051
Further Details:      
 
Domain Number 2 Region: 96-210,294-355
Classification Level Classification E-value
Superfamily RNI-like 0.0000000824
Family 28-residue LRR 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_853996.1.84170
Sequence length 374
Comment PREDICTED: F-box/LRR-repeat protein 8 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MAEPGEQLPEEVLALIFRHLPLRDRATAARVCRAWAAAATCSVVWHDTTISCDCEREGTL
LPYLSACLDHVHNLQLEFEPSREPSRRAATELLTALAGRTPGLQSLRLECRGEKPLFDAG
HDILDAVHAICRAASALRHLDLRRLPFTLDDALVLQAARGCPELRSLFLDNRTLVGSVRP
DSVLELLQACPRLRALGLHLASLSGSALQLLAARDREPFALLALRCACPEDARAPPLPEE
AWVAVRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLSLSGDTVGPVCFAARHYA
TSLRALEVRAAASAELDAALELLAARCAGLREIHCFCVVRPSVLRAFREHCPRLRSYTLK
LTREPHPWMPTTVA
Download sequence
Identical sequences E2REY2
ENSCAFP00000030228 XP_005620916.1.84170 XP_853996.1.84170 ENSCAFP00000030228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]