SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_891827.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_891827.1.92730
Domain Number 1 Region: 70-186
Classification Level Classification E-value
Superfamily Ras GEF 6.8e-18
Family Ras GEF 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_891827.1.92730
Sequence length 315
Comment PREDICTED: ral guanine nucleotide dissociation stimulator-like isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MFSCFQGSRGSGHKKAKRGFLVRFWRHLIRPLTHFRHASHSEPKVCSQNEQEPDSLPKRP
QFNYDSQEYIHQMIHYIPAAIQKRDHICITIFLGVYRTYASTWEVLDLLMRTYASFRPDC
IKDQQTKRAIFRFLFGWFKKYPQDFYESPDLAVVRQFIDYVKRNVPSSDVDRARELLSVL
EDQEAIELQIEQDFATAPEPSEQDASGRQETLAPRPASETEPQGDKQPREDPELVKGAIL
DPFEPKATIELPLSLHQAVPASDGTLSPVDVTADEATGVAADFAADVSPARQLFVSYTVQ
LGTPDFVFPLPEVDI
Download sequence
Identical sequences L7N481
ENSMUSP00000134203 ENSMUSP00000134203 XP_891827.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]