SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_953340.1.9581 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_953340.1.9581
Domain Number 1 Region: 153-213
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000444
Family Tudor domain 0.015
Further Details:      
 
Weak hits

Sequence:  XP_953340.1.9581
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0277
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_953340.1.9581
Sequence length 284
Comment hypothetical protein, conserved [Theileria annulata]; AA=GCF_000003225.3; RF=representative genome; TAX=353154; STAX=5874; NAME=Theileria annulata strain Ankara; strain=Ankara isolate clone C9; AL=Chromosome; RT=Major
Sequence
MDEAETIDDLKANLDEYQKQLATVEDSLKQDPENQELISLKRDLNEVIILTNDLIKYKQS
NEGILLFVKVFLELLKQGVIHLEDIKDVDITTSIFIGRTCVVLYNGKQKYGEVVQVMGDQ
PNDLTVIELLGSREKCSLCLKDLRLLEPPLPAQCKPGSLVQALYGEDGYEDGYIYLFRRW
YDCIINRQTEKGYIVTYKDYNTSEEVQRDRVKTKIKEVKEIVTPAGYVIPENLIIKKTDN
EKEKLRKRKLVQTLKKQQKSQKEDEESYKRASNWRKFQKKVTNF
Download sequence
Identical sequences Q4U8Y8
TA10430 gi|84997237|ref|XP_953340.1| 5874.Q4U8Y8 XP_953340.1.9581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]