SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_968834.1.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_968834.1.52716
Domain Number 1 Region: 334-615,642-721
Classification Level Classification E-value
Superfamily ARM repeat 3.99e-30
Family HspBP1 domain 0.05
Further Details:      
 
Domain Number 2 Region: 70-322
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000549
Family Cyclin A/CDK2-associated p19, Skp2 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_968834.1.52716
Sequence length 724
Comment PREDICTED: protein zyg-11 homolog isoform X1 [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MYESPNSLEDLCLDTICDNILIYVKLDHTNAGKRYKFADPDLFLFKELSEKLLGKFLEKN
ILCDALMFIFSEKNTKLSTVKLKNCKVTQNGLEILKQHKILDLECVNLKNVCIGNIIDCL
NEHSIRNMTNVNFAKCSFIDVQRHSLMVKITQFKNLRSLNLAYTELNQHCLNMICEDLKL
LEKLDISGTGTGIKDLSPLRQLLNLTSLAISDLSQSANYVSTLTHLSTLRHLDVSVFNEK
LDHLTTSNVVKLLDDVTTLPHLVSLDVSGWRDFIPTETLLKYVETHPKLEFLGIVLTDCT
FDSLFSSTNQWPNLTIAGLGNENQIKVTLKKYRERSNYVQKALYHLFQLTNLSPDARPDM
FNLVLPVMAAHSNKFGVQMAATACLYNLTRGDLSKKIHPKSLSRGVNLTLYAMECFPDEF
QLQKNSLLTLCSDTILQEINFDRFRCAKLVLDALCTFEDVNMNRMAVAICSILAAKVSTE
ETSELGARPVYMRKLLAMVQNRVESGVSDITLKFTLSALWNLTDESAATCTVFLEQGGAY
LFLKVLKTFKDDSAIETKVLGLLNNIAEVVKLRHSLMMDPLMNELFVLLKSENIDVSYFA
AGIVAHLASDGAEQWTVGSHTREEMLGELKNAVSQWKVPDSEMVAYRSFRPFFSLLRIEM
DYQVQLWAVWAIHHVCTKNPKRYCVMLQDENGHLLLSDLINYTDSHPDIKSISSQILETV
AGHV
Download sequence
Identical sequences D2A447
7070.D2A447 TC015823 XP_968834.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]