SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_969309.1.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_969309.1.52716
Domain Number 1 Region: 103-465
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000102
Family 28-residue LRR 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_969309.1.52716
Sequence length 475
Comment PREDICTED: uncharacterized protein LOC657780 [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MSPKNQVHPLSYLCVKLVSAQLIQALSDDEGRNYDVVLEYLFDATYEVVQELLKNILNSV
NLDAATRFSCLQVLLRQDVRKLDTGIFPHSYYEAILKVITQKGTGLQQLNLKGVWVRDHP
AQLSELVTNLTKLKILVIPHMADDQVLQAISKAQSLSVLDISGECSFTSSGLRLIRNETL
TCVDIGYFGKKSICQQDESDCDIIAEMIENLPNLTCLRTYSFTGTSLLTLYRKNSKHKTR
LKYLHDTGTSDEVIEAIINMCEQLKSIHLDTPQKGVICRLKQLKKLNCIKLVHHDSADLL
DYLADSGAALQVLKLNHNKRNALDLCDVCLCVPNLHTLECFQLKLAFSQMDTFFMNLENI
EILYCDVSDSSLKCILMNCPFLKRVIIGCVINMTDGDVFRLCAECDFLCLEELWLSCARG
LTCISVELLMGHCPNLKVLGQLSGWDIHQEEIEYLRSVILYTNTDLTLLPLGTFS
Download sequence
Identical sequences D6WCY7
XP_969309.1.52716 TC004956 7070.XP_969309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]