SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_970340.2.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_970340.2.52716
Domain Number 1 Region: 287-596
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-49
Family Kelch motif 0.0061
Further Details:      
 
Domain Number 2 Region: 68-188
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-18
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 3 Region: 879-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000023
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  XP_970340.2.52716
Domain Number - Region: 658-694
Classification Level Classification E-value
Superfamily Plexin repeat 0.000488
Family Plexin repeat 0.0032
Further Details:      
 
Domain Number - Region: 816-837
Classification Level Classification E-value
Superfamily Plexin repeat 0.0159
Family Plexin repeat 0.0047
Further Details:      
 
Domain Number - Region: 711-740
Classification Level Classification E-value
Superfamily Plexin repeat 0.0262
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_970340.2.52716
Sequence length 1253
Comment PREDICTED: attractin-like protein 1 [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MLEIFQMFLFLFKSKYRRKCYVWQALCCAVVVLNVCSLVKAKCADCSGNGVCKNETCVCY
DGWQGPQCQFCGGKVRLGTSTGTIHDGLGNYSLSVKCSWLIDAPNTSITLHLEEFATECG
WDHLYIFDGDSVDSPLLAVFSGLMYKGDYNIRRIPEIVAYSGSALVHFFSDDAFNMSGFN
MTYRLNACPSKISGVDCSGNGICIDQVCTCNGGWTGVACHLQKCPDNCGQHDGRGRCEPE
FGCRCESDYKGDDCSQYAPSGYWETVNVESFVPPGSASHGAAVWRDSMYVIAGESYSRRF
MLYVYDFNGNVWETPYISESPSQRYGHSTVIYGDKIFLYGGVMGNRGPTSEVWAFDINAK
TWENITVKAVACNSSVLMCGPLKSAGHTATVIENSTNRKADRMIVLFGHSPHLGYLNTVQ
EYYFGTREWHIVATKGYPVKGGYGHTATWDPLTGKIYVYGGVVSENESAQVLSKSLYSYD
PNTRVWVLLKDAPSARFLHTSTFISGGLMLVFGGNTHNDTLHSFGAKCYSSEFLAYDVTC
DTWQVLQVPKDIHADLARFGHSAVTFEGSLYIYGGFDGQMLSDMLKYTPGSCTNFITSNE
CLSKKPGVKCVWDMRNNFCTAIQNIPVKNLTVQLDGLIIRCPELSRTMITQSLIQNENRC
EKFEDCLSCVQTTSECVWCGNSCMHNKKCRNSSEANIAKLEQCPLDPSPICKQLHTCSAC
TSQPFCRWRFEHAKCVTHPLPSNVTAAAAEPIQCQKVCSEYNSCLNCTQEECIWCQNEGR
CVDKNAYTASFPYGQCREWTTVGSKCRTRGANENSQCSFYSTCAKCRDDPACGWCDDGSR
TGLGKCMPGGYAGPTLHTHSLPSSTCPPDRWHFTTCPLCQCNGHASCIANSSVCLPCQNL
TMGTQCEHCVKGYWGNPVNGGKCQPCECNGQATHCHPESGKCYCTTKGLIGDHCEKCDAT
NHYNSDPINKDSCYYDLTIDYQFTFNLSKKEDRHFTQINFRNSPIKADIDADFSITCSVL
AKMNITIRRGGSKEEKPIYEDFNCTTFRTKFPKSDYNFGVEDNITLTTFYVYVYDFQPPL
WIQISFSQYPKLNLQQFFITFSSCFLLLLLFAAILWKIKQRYDMYRRRQRLFVEMEQMAS
RPFSQVLVELEVKEKLDFDNISVIDLKRKKRDAPSPIALEPCYGNKAAVLSLLVRLPTGC
EPYTVKGQSAGLAIASALVTLGNPRKMSIDQVKTETKSGKSRKSQSQHPDSCL
Download sequence
Identical sequences TC012834 XP_970340.2.52716 7070.XP_970340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]