SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_973014.1.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_973014.1.52716
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 3.81e-83
Family SSRP1-like 0.00000327
Further Details:      
 
Domain Number 2 Region: 545-622
Classification Level Classification E-value
Superfamily HMG-box 5.5e-23
Family HMG-box 0.0000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_973014.1.52716
Sequence length 712
Comment PREDICTED: FACT complex subunit Ssrp1 [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MDFLEYSDISAEVKGCMTGGKLKMTDQNIIFKNSKTGKVESISASDFEAVNFQNFAGSLG
IRVFLKNGTLHRFVGFKDAEKERIAKFFSNTYKIDMLEKELSLKGWNWGTAKFNGSVLSF
EVGHNSAFEIPLNHVSQCTAGKNEITMEFHQNDDAPVSLMEMRFFIPSNELAGDVDPVEA
FQKQVMKKASVISVSGDAIAIFREIQCLTPRGRYDIKIFQTFFQLHGKTFDYKIPMSTVL
RLFLLPHKDNRQMFFVVSLDPPIKQGQTRYHFLVLLFGQEEETSIELPFTDEELKDKYEG
KLDKELSGPTYEVLGKVMKVIINRKLTGPGGFVGHSGTPAIGCSFKAAAGYLYPLERGFM
YVHKPPIHIRFEEVASVNFARGGGSTRSFDFEIELKSGTVHTFSSIEKEEYNKLFDFITT
KKLNIKNRGKNDKGGYNDDFGDSDNEAAPDAYLERVKAEAQERDEDDDDGPSEDESTDED
FKPTQDESDVAEEFDSSPSSTSSEDEEKGSGDEHKKKHKKEKKEKKEKKKPAKTVSEKPR
QKRAKKSKDENKPKRPSTAFMLWLNEMRDKIKADNPGIKITEIAKKGGEMWKELKDKSEW
EGKAAKAKEEYNKAMKEYEASGGSKSEDKKSSEKKAPAKKKTSSMPSVKPSQVKSREFIE
DDDSSSDSDDDKGKKRKGSDSERGKPKDKKKKNKSESEESTPASSDANSDSD
Download sequence
Identical sequences D6X1B7
XP_973014.1.52716 7070.XP_973014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]