SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YP_003024030.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YP_003024030.1.92137
Domain Number - Region: 20-50
Classification Level Classification E-value
Superfamily Sec7 domain 0.00785
Family Sec7 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YP_003024030.1.92137
Sequence length 68
Comment ATP synthase F0 subunit 8 (mitochondrion) [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICS
LHSLPPQS
Download sequence
Identical sequences P03928 U5YV54
ENSP00000355265 ENSP00000355265 gi|251831111|ref|YP_003024030.1| ENSP00000355265 9606.ENSP00000355265 YP_003024030.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]