SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_003770452.1.66228 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YP_003770452.1.66228
Domain Number - Region: 127-175
Classification Level Classification E-value
Superfamily Prim-pol domain 0.0785
Family PriA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YP_003770452.1.66228
Sequence length 319
Comment ATP-dependent DNA ligase/DNA primase [Amycolatopsis mediterranei U32]; AA=GCF_000196835.1; RF=reference genome; TAX=749927; STAX=33910; NAME=Amycolatopsis mediterranei U32; strain=U32; AL=Complete Genome; RT=Major
Sequence
MSGDEVRHGVKLSSLDQEVFPDAGVTKRELLDYLEAVSGRMLPELHDRLLSVVRVLRGQG
PFMQKNLPKYTPEWVERRALWADRSRREVVYALCNDLRTLLWFGNQRAIEYHTTLFRGEP
ANGPTHLILDLDPPADAPFSLAVGAAKLVREALRKDGLDGAVKTSGSKGVHVFVPLAAGQ
STEDIAAATRAVAARAERIDPALGTTEFVVERREGKVFLDSTRAGGATVVSVYSPRHRPG
APVSFPVRWAGLDDVKPADFTVHTVPGLLGDGDPWTEEMPEPFVLPADLVEEGHTIPIAR
VVAMHEGKRRARAARESGS
Download sequence
Identical sequences A0A0H3DGL6 G0FZ80
gi|399542041|ref|YP_006554703.1| gi|300790161|ref|YP_003770452.1| gi|399542041|ref|YP_006554703.1| gi|532464903|ref|YP_008464555.1| WP_013230081.1.26188 WP_013230081.1.53613 WP_013230081.1.63706 WP_013230081.1.79787 WP_013230081.1.88400 WP_013230081.1.99940 YP_003770452.1.66228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]