SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YP_009120151.1.13463 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_009120151.1.13463
Domain Number 1 Region: 139-162,218-281,438-511
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000249
Family Ankyrin repeat 0.012
Further Details:      
 
Domain Number 2 Region: 714-792
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000144
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YP_009120151.1.13463
Sequence length 862
Comment ankyrin repeat protein [Pandoravirus inopinatum]; AA=GCF_000928575.1; RF=na; TAX=1605721; STAX=1605721; NAME=Pandoravirus inopinatum; AL=Chromosome; RT=Major
Sequence
MFTANRKRGSAHDGCDPLTQRMPGRKRQRADMDRLDMPLPPAEGGPYKNGETTVVARLKH
IPDSVIEAIVDSLDDRDFGACMVASRLFWVCSKARARARLLSKTLTSDEAVLLDDPARVL
DYMRQRRGVRFRPHHLRVAAKHGRTDAVRWLVDHADWHVDDASTMALWLASDGMAPVAAV
AESDVDACHETCRYDGPKRPGESCPSCGPSRVVDQRRTDGTTIRVPLCLCAIGDAAAKRG
HRRALDVLLGARGYGHTDFAVLLAAANGHTDMAEYLLDQSNVAVLLGSWWPDDDIVSQTV
CRGRVDLALRVFEAGGRACSPEVLARYVPDSVVRWRARALWTDTMNEPDYYGDADTDDEE
DESDRDQESDDQPNDGDVEDNDTDDPIGDSVDGLMEDDDDDQDTNDTLAQMRQKQHCDKT
DRDAYAKMRQVLDSGLIAPDKVQRAVDRALVCAVNRGRMTLVRLLHEKHGARLTDDGVPA
GQRHRGHNHNEPVASAAVNNDVRMLAYMVSRRGTAVVGPDAMDDAARRGALAALTYLADH
SDARPSPRALKRAASAGHAATTSFLCMRVPDQCRIGPALRRALAGGHHMVTAVLLEHAST
ADVRYALRTALGDDRARLCRALALRGDLHEGDLKTPGGDGPVAPTRVALALRQLSKAQGQ
SIDAFVACVDKWGHETAVAAYANHPIQDSEACNGRIDLLRALLRLGLGTATHNGMSNAIF
NGHVNAMRLLHGHYGDQGPWVGRTFDDAVANGHIKALVFMHDHFAWAWWSADAVDRAAAA
GRLNVVRFLYARRSPDRPWCTAAALDGAIHGTHWRVAAFLHAAGARCTPAVIDRALAAKR
SCCCLWLTPLMEAIRERSLAAA
Download sequence
Identical sequences A0A0B5JAG1
YP_009120151.1.13463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]