SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YP_053757.1.45369 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_053757.1.45369
Domain Number 1 Region: 26-334
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 8.85e-67
Family Glycosyl hydrolases family 32 N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 334-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.04e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YP_053757.1.45369
Sequence length 483
Comment sucrose-6-phosphate hydrolase [Mesoplasma florum L1]; AA=GCF_000008305.1; RF=reference genome; TAX=265311; STAX=2151; NAME=Mesoplasma florum L1; strain=L1; ATCC 33453; AL=Complete Genome; RT=Major
Sequence
MQKEKYSLISNNDLEDIQKWHDKKQSDWYNNQFHLAGYSGSTNDPNGLTYHKGKYYIFMQ
SCPFSIQHFNKSWALYTTTDFINYNYEGLTLIPSTKYDINGVFSGSARINENDEIEIYYT
GNIKFNDVDRTAYTLKAFIDLKEKLVTKELLFEADLTKYTGHYRDPIVFEKNNQLYMLNG
AQTKDLKAMLNVYRFNGSNWENFKDIKFDEADEQNAYMLECPNYFKLDGREYVFACLEQD
APLKDGSHYVKYREVEIDNDINFTYKTSLLKIDLGFDFYAPQVFSNTGERVIMLGWLGNS
KSNPFPPELTTWSNQLTVPRDLFVKNNKLYQLPIKELDELRVNEIKGFENVYAYENGLTE
ISATDINNEFEILIKNEKNENIKISNINNKFIIDRSETTFKDDENLPPLINLDDLNVQSI
RILVDRSVMEIFINEGEHAVSVRFYINEHNKILTNLKNVKINQLKGYSYNWNNIIFKNEI
KGQ
Download sequence
Identical sequences Q6F0V0
265311.Mfl515 YP_053757.1.45369 gi|50365332|ref|YP_053757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]