SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YP_144998.1.19876 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_144998.1.19876
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily TT1751-like 2.27e-34
Family TT1751-like 0.000000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YP_144998.1.19876
Sequence length 129
Comment hypothetical protein TTHA1732 [Thermus thermophilus HB8]; AA=GCF_000091545.1; RF=reference genome; TAX=300852; STAX=274; NAME=Thermus thermophilus HB8; strain=HB8; AL=Complete Genome; RT=Major
Sequence
MTGMRKTLKATLAEARAQVEAALKEEGFGILTEIDVAATLKAKLGLEKPPYLILGACNPN
LAARALEALPEIGLLLPCNVVLREAEEGVEVLIQDPKEMFRVLPEATQRALAPVAEEART
RLSRALSRL
Download sequence
Identical sequences Q5SHJ8 Q84BQ8
300852.TTHA1732 gi|55981701|ref|YP_144998.1| ttk003001751.1 1j3mA 1j3m_A 1j3m_B cath|current|1j3mA00/3-129 cath|current|1j3mB00/203-329 YP_144998.1.19876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]