SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YP_887078.1.77314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_887078.1.77314
Domain Number 1 Region: 18-283
Classification Level Classification E-value
Superfamily Cgl1923-like 1.19e-85
Family Cgl1923-like 0.000000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YP_887078.1.77314
Sequence length 348
Comment hypothetical protein MSMEG_2746 [Mycobacterium smegmatis str. MC2 155]; AA=GCF_000015005.1; RF=reference genome; TAX=246196; STAX=1772; NAME=Mycobacterium smegmatis str. MC2 155; strain=MC2 155; AL=Complete Genome; RT=Major
Sequence
MADNENPQQRYQPDQSGMYELEFPAPQLSSSDGRGPVLIHALEGFSDAGHAIRLAAEHLK
KSLDTELVASFAIDELLDYRSRRPLMTFKTDHFTAYEEPELNLYALHDTVGTPFLLLAGL
EPDLRWERFITAVRLLAEQLGVRQVIGLGTIPMAVPHTRPVNLTAHSNNKELIAEHTPWV
GEVQVPASVSNLLEFRMAQHGHEVVGFTVHVPHYLAQTAYPPAAEALLAEVARTGSLELP
LAALSEAGAEVYTKINEQVEASPEVAQVVSALERQYDAFIAAQENRSLLARDEDLPSGDE
LGAEFERFLAQQAGEKFKDDKYKDGHGEGFGGRIRGTVTTTDDVPDQG
Download sequence
Identical sequences A0QVZ0 I7G7B0
WP_011728558.1.56412 YP_887078.1.77314 gi|118471616|ref|YP_887078.1| gi|118471616|ref|YP_887078.1| 246196.MSMEG_2746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]