SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SNOT_00414 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_00414
Domain Number 1 Region: 20-275
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.32e-86
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0000000642
Further Details:      
 
Domain Number 2 Region: 364-529
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-49
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.000000716
Further Details:      
 
Domain Number 3 Region: 276-357
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000000118
Family Rhamnogalacturonase B, RhgB, middle domain 0.0000661
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SNOT_00414
Sequence length 530
Comment | SNOG_00414 | Stagonospora nodorum hypothetical protein (531 aa)
Sequence
MLIKSPLLAVAAFSSSALAAFGASQSGDTITIDAGSANPLIFQVNSKSCDVRSIKYRSEE
LQYPSTFTHIGSGLGSATVKYEIISNQYVKVTCTTSTLTHYMVVRSGDPTIWMATYTTAE
PSIGELRFLARLNNKILPDQYPYDLVSTTGGSSSTIEGSDVFVVNGQTRSKFYSSERFID
DTRHCVNSGAVHACMLMNSYSYEGSSGGPFFRDINTNNNGDYTSLTFYMNSGHVQTEKFR
MGLHGPYGLAFTRSGIPEGGNKLDTTFFKDLGITGYVAPSARGTVTGTATGIGSNFQKVL
HWYNDAAQYWAYADSAGNFASPAMKPGTYTQVLYRGEFKVKASSVTVSAGKATTANIAAD
TETKTSIWRIGEWDGQPTGFRNADKQLRMHPTDSRMASWGPLTYTVGSSTLNDVPMAIVK
DNNPLTIKFTGTHTAAATLRVGTTLAFAGCRPAVVVNGYSPANPAAPSKIDSRGLTRGAY
RGFGEVYNYDIPAGKLVSGSNSITISCLSGSSGGGFLAPNVILDAIELFK
Download sequence
Identical sequences SNOT_00414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]