SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SNOT_05946 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_05946
Domain Number 1 Region: 20-271
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.29e-62
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.00000144
Further Details:      
 
Domain Number 2 Region: 362-525
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-43
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.00000501
Further Details:      
 
Domain Number 3 Region: 275-353
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000392
Family Rhamnogalacturonase B, RhgB, middle domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SNOT_05946
Sequence length 527
Comment | SNOG_05946 | Stagonospora nodorum hypothetical protein (528 aa)
Sequence
MHLITSVATVLSIGQGVSAAFGLTSTTTGYKVDTDGGLVFEINKSTGDLTSLNYNGVEYQ
GTVKASGINSGLGSSTVTAETINGFIKITAKSSSLPVTHYYIAKPQEASIYMATNNQGEV
DPGELRFLARLQVSEVPTGVHGNVGDVRGCTAIEGKDTFRCSDGHTACKMYTSDRFIDDK
VHCVSGSKAQVCMSMPGLAYETSSGGPFMRDINSQTTDPDQELYFYMNSGHVRTEAWRSG
LKGPYAITFQPAGASPPSAPDTSFFGSLKIDGYVGESGRGSVTGKATGVDSKFETVLHWY
NDAAQYWTKASGGNYKSPAMKAGTYNMKLYKGEFVVATDTVTVTAGQTASKDIASKEVSP
AVIWRIGEFDGQPFELKNGDKITRMHPSDVRMSSWAGSYTVGTSKASDFPMALWAKQNTA
ANVTFELTSAQVKAHVLRVGTTLSFKGGRPSVKIGSWTGTDPGAPTLIDSRGVTRGAYRG
FGEVYTWTVPASAFQAGANTLTMGVSGSGDAEWLSANYIVDAVELQD
Download sequence
Identical sequences Q0UQL8
SNOT_05946 XP_001796336.1.30160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]