SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SNOT_11242 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_11242
Domain Number 1 Region: 27-334
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.46e-47
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.022
Further Details:      
 
Domain Number 2 Region: 442-659
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-19
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.044
Further Details:      
 
Domain Number 3 Region: 340-436
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000167
Family Rhamnogalacturonase B, RhgB, middle domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SNOT_11242
Sequence length 661
Comment | SNOG_11242 | Stagonospora nodorum hypothetical protein (662 aa)
Sequence
MSSNIGLYLTEFLLSLPFWASMVQAAIKSSENNNTIDISNDRLSFTVAKGTGYVSKLSLD
GQNLLGSGRGPYLDGHLDSGFWTPGKGAKYQLFKGTDGDGKTYAGAMMSQGYQTTGIVFE
QYWFLRDGETGLHVFSRAKYSNSSVPSGGDLGEFRQLFRPSGSVWTHLSSSDEMFAPLPN
TTGAPVVQDASWYVGGSKSDPYVKQVSDYFTKYMFSEEWRDQTVHGMYGDGTKSSDGTNF
GAWLLMNTKDTYFNGPTHSDLTVDGIVYNYMISNHHGNGVPELANGFDHTFGPVVQQVYY
FNIGSKGTSLQSLRSDAKKMVSTNWAAFYDAIAQHVPNLVPSTGRGTFKATVSLPKGATR
ALAVLAVDGHDFQDNNKIPSAYQYWGNIEKSGSVTIPSVKAGTYRLTVYADNIFGQYEQD
GIVIKAGSLATTTATWNAESAGTELWRIGTPDKSSGEFRHGNEEDTTRTNQPRQYRLYWA
VHDFVKDFPNGVKYHVGNSSLYELNYVHWSVFGGKANYLRKDPYYTNVNNWTLTFDLTQN
QISNKSEATFTIQLAGVKTSAGNNDAAAPGKAWADLPYNVIINGRQLETWVIPSTHSSSC
AVRSAATCYTTGHKFKFPVSQLKEGYNEFVLSLPARATAPEDAELPESVYVQYDALRLEV
K
Download sequence
Identical sequences SNOT_11242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]