SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54026958|ref|YP_121200.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54026958|ref|YP_121200.1|
Domain Number 1 Region: 23-130
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.36e-25
Family alpha-D-mannose-specific plant lectins 0.00013
Further Details:      
 
Domain Number 2 Region: 164-212
Classification Level Classification E-value
Superfamily LysM domain 0.00000000379
Family LysM domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|54026958|ref|YP_121200.1|
Sequence length 212
Comment hypothetical protein nfa49840 [Nocardia farcinica IFM 10152]
Sequence
MGFRLASQVGCCAQKIFERNNVGDTLRVGEELGLGQSLTGGAYTLTLQPDGNLVLSEPGG
NVVWATQTHDQGVDKAVLQHDGNFVLYKGADAAWSTETNGKSADRLVVQADRNVVLYGTD
GAALWASGTNTDNPLPAPEQQAEQAPAAAPVEDVPPPPPAPQPRTYTVEPGDTLWAIAER
FYGDGNRYQEIADASGIPNPDAINPGQVLTIP
Download sequence
Identical sequences A0A2A7UHK5 Q5YPQ5
gi|54026958|ref|YP_121200.1| 247156.nfa49840 WP_011211519.1.31130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]