SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54027601|ref|YP_121843.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54027601|ref|YP_121843.1|
Domain Number 1 Region: 240-340
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000439
Family Coronavirus S2 glycoprotein 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|54027601|ref|YP_121843.1|
Sequence length 367
Comment Mce family protein [Nocardia farcinica IFM 10152]
Sequence
MTNRMRIKARRALIALAAVTAVGTTSGCGLTVEDLPLPKPGQAAETYTLHAVFENALNLP
DQAKVKIGGSDVGVVTNITTKNFQAVVDLSIDKNIELPRGSTAELRQATPLGDVFIAVSK
PKAEPGAAMLQDGDTLTLEQTSAGATVEQLLISVSMLFNGGGVAALSKLGSELDAIVGGR
GPQLAHLITELTGVVGSLNENSQRVDAVLGEFHTLANTIESKRGELGEVADTLPQMIGAV
AENNRAIGDMLTKLSTASAAIGDYSNTSSEQLQSLLENTHQLMNALAATGSDFEVLLDRL
HEIRPKVDNTFRGRSFAVYATATNLDISALTDPANAGLWDLHDLQDFAGSLIQVLQLVQN
RVEGGHR
Download sequence
Identical sequences Q5YMW2
WP_011212161.1.78782 247156.nfa56270 gi|54027601|ref|YP_121843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]