SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGUT_00540 from Candida guilliermondii ATCC 6260

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGUT_00540
Domain Number 1 Region: 60-148
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.36e-21
Family Cold shock DNA-binding domain-like 0.0000815
Further Details:      
 
Domain Number 2 Region: 150-248
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.3e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00032
Further Details:      
 
Weak hits

Sequence:  PGUT_00540
Domain Number - Region: 3-60
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0157
Family ECR1 N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGUT_00540
Sequence length 249
Comment | PGUG_00540 | Candida guilliermondii hypothetical protein (250 aa)
Sequence
MSVIIPGDHIPPNEVKTTIGPGFYRQPITDNVVPVSAGIVHDKINKQGTNRLLYVDSNSK
RYIPQVNDFVIGIVTGVIGEAYKVSLQGFSSSVSLSMMAFPNANKKNRPNLKNGQAVYAR
VTKAMSEIESEIECMDSSGKEGGFGVLSESGLIFEVNLHYARDLLFSHNSPILEKLSSKC
KFEIAIGINGKIWIKCGEGLVDVVNEDQDEATMIHDMKTTLAASRYIKNCAKSAPEDFDR
QLKEAFKGL
Download sequence
Identical sequences A5DB85
4929.A5DB85 PGUT_00540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]