SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGUT_01365 from Candida guilliermondii ATCC 6260

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGUT_01365
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-25
Family Cold shock DNA-binding domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGUT_01365
Sequence length 244
Comment | PGUG_01365 | Candida guilliermondii hypothetical protein (245 aa)
Sequence
MTKQNFVGLVVSQGKMHKTVKVRVQTKTYDKKVHKEVFKRKDYLVHDEGNLCKEGDIVRI
ESIPKISSRKYFAVAEMKVNKGQQFAMYESLAKKKVAEEEKEKLQNFLLKNEQSQAIISQ
VEDLRKLDQIHQQFQSNPEADKDLLVEEINKIKAKYNIKSWPSTEPILSLELNQDEADMT
EIEKRAKNIKSILEKVMGPEHTEFRERVLAEKAKAPIANLKPFTQKNILRKFILDPRNEC
PVPY
Download sequence
Identical sequences A5DDL4
PGUT_01365 4929.A5DDL4 XP_001485694.1.35779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]