SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGUT_01527 from Candida guilliermondii ATCC 6260

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGUT_01527
Domain Number 1 Region: 34-192
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.51e-62
Family Glutathione peroxidase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGUT_01527
Sequence length 192
Comment | PGUG_01527 | Candida guilliermondii hypothetical protein (193 aa)
Sequence
MIMITNTTAAHQSAHPYTSGYMMARIASPQIIMTSFYDLTPNDKTGKPYPFEELKGKVVL
IVNVASKCGFTPQYKELEELNKKYKDKGLQIIGFPCNQFGKQEPGTDEEIGQFCQLNYGV
TFPVLQKVDVNGDKASPVYKYLKEQKAGLLGLTRIKWNFEKFLIDKNGNVVERFSSLTKP
SSLASAIEPLLK
Download sequence
Identical sequences A5DE26
4929.A5DE26 PGUT_01527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]