SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGUT_03304 from Candida guilliermondii ATCC 6260

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGUT_03304
Domain Number 1 Region: 120-222
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0056
Further Details:      
 
Weak hits

Sequence:  PGUT_03304
Domain Number - Region: 77-134
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0445
Family Gametocyte protein Pfg27 0.013
Further Details:      
 
Domain Number - Region: 42-76
Classification Level Classification E-value
Superfamily YejL-like 0.0785
Family YejL-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGUT_03304
Sequence length 340
Comment | PGUG_03304 | Candida guilliermondii hypothetical protein (341 aa)
Sequence
MPSTHNRDKPWDTPDIDKWHVDEFKPEDNASGLPFAEESSFMTLFPKYREQYLRTIWSEV
TKALDKHNIACQLDLVEGSMTVKTTRKTYDPAIIIKARDLIKLLARSVPFPQAVKVLQDD
VACDVIKIGNFVTNKDRFVKRRQRLVGPNGNTLKALELLTNCYILVQGNTVSAMGPYKGL
KEVRRVVEDCMKNVHPIYHIKELMIKQELSKKPELANEDWSRFLPMFKKRNVARKKKAAP
DKKKVYTPFPPAQTPRKVDLQIESGEYFLGKREKKQNDLQKKRDKQEEVSEQKNKEKLRG
YEAPEEQLHENKLLKKSKKSKKRSHDEDEGSNKKPRVDSD
Download sequence
Identical sequences A5DJ53
PGUT_03304 4929.A5DJ53 XP_001483923.1.35779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]