SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGUT_05828 from Candida guilliermondii ATCC 6260

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGUT_05828
Domain Number 1 Region: 616-695
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000095
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 691-772
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000731
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 781-889
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000199
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 4 Region: 936-1012
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 5 Region: 147-245
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 6 Region: 1133-1190
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Weak hits

Sequence:  PGUT_05828
Domain Number - Region: 296-376
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000171
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 
Domain Number - Region: 542-613
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGUT_05828
Sequence length 1191
Comment | PGUG_05828 | Candida guilliermondii hypothetical protein (1192 aa)
Sequence
MSTPAEIIAARVNGQADAAPTDATPSNSSELTDSPKTPSVTDESAFPTLGGKKASFSTLS
SWGPSMKKGANASESAPSESKPAVSVAAGKFKSSTIQEAFSLDVEDQLNVARTEFIKILT
QIRGDTDTNIECTTSQHTKKRTFLITGKPAQVRDAKRMVIKRLTKPVKISFDIPAKVRSR
VIGQQGRTLKPIIADNDVKIDIGNPQEVEGVDPDDIYSSVVTVSIEGDVEGCKHAKGRIL
AIVKDEIKELSVRLPVDDALKPFVANAIAPIISKFSSLDISAPIYSSPSNSVTLVGDREL
VLEAKQEIIDTLEALAPQISTQEVPIPKLKHQFLPIDDVLRAFNVLIQLPKDGESSVKFV
GKKQDIPKAQEMARSTTSSYKVEALDMAKAHNGNLTHVKAVATLLKQNGTFDRIGRENDV
SLNVPDVSVLADSATTSVPIEIVVKNDQAENTKNAKKAIVANVNSISPSSTKVISDIDSF
LMPSVKETIKDVTEKNNVSFVILGSDITLFNFSNESEDFDFVDTNEAFTEVDTELNKLRE
LQKDLDTVVIKVSSSKQREIAGPRNTTLKLITDSADANSVQVKLHSNADEVLIRGVATQV
AIVKDLINAVLSDAGEHGENYSSTAVVASSVLSRLIGKNGANMTSLREKYGVKINVPEHE
SEQSQNQTSITITGPKFNVEECKKNMIETSKKWADETVKRLNIESKFHRRLIGANGVYIT
RLQDKYNVKIRFPSAESFASTFSDAPKHKDEVTVKGPSKGVAKAVQELEEFYQFQKENGF
QEILHIPAQAISRVIGKSGATINDIADGAGVEYHFKKNAKANEEENSSEKSSELELIGSK
SALREAKMKIQDIINEVENTVSETIKVDPKYHRDIIGSGGSKMKEIIANAGGAELSGPKY
YKLMAMPSESSGSDEIVCQGDKQIIAKIIEQVKALVAEKEASVSEQYELPKEKHGRLVGP
GGSVRHALEDEFKVSIAIPRPSDMSSIIKLTGLPENIAKLRPKLDELTKNEWKVELEIPE
KYHILVSERGGIFRKLKTDYNIDVVHGNLTRKASKLTNASIPTPPEEAFAESEEPTKVTI
SSAEPVSEEDTIPWRLVGSEEDTARAAELIKERLQFAKEADSRGWIFASNPGSFSKVVGP
QGARISQLRKKFNVFVIVPRKGDKHEQFIYLVGKQDAIEAASKEIVKLLQA
Download sequence
Identical sequences A5DRC7
4929.A5DRC7 PGUT_05828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]