SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGUT_04527 from Candida guilliermondii ATCC 6260

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGUT_04527
Domain Number 1 Region: 132-252
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000076
Family Thioltransferase 0.079
Further Details:      
 
Domain Number 2 Region: 327-405,432-467
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000847
Family UBX domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGUT_04527
Sequence length 469
Comment | PGUG_04527 | Candida guilliermondii hypothetical protein (470 aa)
Sequence
MTSLFDNLARRFLGQQYAPVSTSEDPESQVRVPGSFAATPEGNQVANSNVSEGHNRLPGD
APIGEEPATAPRAALTSHNLNHVLFRFSTICQLLVYKPLMVVSVLICRVVAAFINVIYFR
DEYAATANNPSDPIDNANKFIRELEYNLQPSEPMHTLPPFFQGSYTQALFMATNRAKFLF
VYLAHPRSENSSGMFENIITAPEFTSIFNDPDYIIWGGDLTSSESYQLANSLNVTRFPFL
GLMCLTRSTTMMPSGPVKSAPKISLVSKVQGRVKDRARAQAIISNKFKNRINKYEADLRE
IRHELMNKYMSQVLVKQQDISYQNSLARDKAKKLKREREGKLSAYLQSKVEHFLQLQNSQ
SPDSARVGIRFSNGNRVTLTLPSTTKVAEIYEFVEIHRRGYDTEPQTLSSQNGQNSQNSL
MSLEIAPDDFKFSLVSSVPPRSSLKDFWESSVRDVNFIYPNGMLIVEDI
Download sequence
Identical sequences A5DMM6
PGUT_04527 4929.A5DMM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]