SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|111915|estExt_fgenesh2_kg.C_280010 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|111915|estExt_fgenesh2_kg.C_280010
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily EF-hand 1e-55
Family Calmodulin-like 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|111915|estExt_fgenesh2_kg.C_280010
Sequence length 149
Sequence
MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN
NGSIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDD
EVDEMIREADQDGDGRIDYNEFVQLMMQK
Download sequence
Identical sequences A0A024S2B6 A0A0F9X1Z0 A0A1T3CVM4 A0A2H2ZY92 G0RR49 G9NDR1 G9NIW3
jgi|Trire2|80447|estExt_GeneWisePlus.C_180262 51453.JGI80447 jgi|Triha1|498316|fgenesh1_pm.12_#_43 XP_006967657.1.9351 XP_013947876.1.20613 XP_013949405.1.71794 jgi|Trilo1|160140|CE91042_94530 jgi|Trias1|62411|fgenesh1_kg.17_#_148_#_Locus175v1rpkm677.16 jgi|Trici1|22811|fgenesh1_pg.13_#_281 jgi|Trive1|111915|estExt_fgenesh2_kg.C_280010 jgi|Triat1|146638|estExt_fgenesh1_kg.C_130016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]