SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|27826|e_gw1.1.858.1 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|27826|e_gw1.1.858.1
Domain Number 1 Region: 3-348
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.92e-125
Family Motor proteins 0.0000000000241
Further Details:      
 
Weak hits

Sequence:  jgi|Trive1|27826|e_gw1.1.858.1
Domain Number - Region: 637-693
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 0.0619
Family MPP-like 0.031
Further Details:      
 
Domain Number - Region: 778-859
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0863
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|27826|e_gw1.1.858.1
Sequence length 920
Sequence
MSNNSIKVVARFRPQNRVEIESGGKPIVTFTSDDTCTLDSKEAQGSFTFDRIFDMSCKQQ
DIFDYSIRPTVDDILNGYNGTVFAYGQTGAGKSYTMMGSNIDDPEQRGVIPRIVEQIFAS
IMSSPSTIEYTVRVSYMEIYMEKIRDLLAPQNDNLPIHEEKNRGIYVKGLLEIYVSSVQE
VYEVMRRGGSARMVSATNMNAESSRSHSIFVVTITQKNVESGSAKSGQLFLVDLAGSEKV
GKTGASGQTLEEAKKINKSLSALGMVINALTDGKSHYVPYRDSKLTRILQESLGGNSRTT
LIINCSPSSYNDAETLGTLRFGTRAKSIKNKAKVNAELSPAELKALLKKAQGQVTNFESY
ISNLEGEVQLWRAGEAVPKDKWVQPIADGVSAAKAEARAPRPSTPSRLTESRSETPTASD
RAGTPSITLEKDEREEFLRRENELQDQITEKESQAATAEKQLRETKEELSYLKEHDSKMG
KENEKLLTEVNEFKMQLERLNFEGKEALITMDALKEANSELTAELDDMKQQLLDAKMTAK
ETGAALDEKEKKKAEKMAKMMAGFELGTDVFSDNEKSIAETIKHIDALLEQSTIGDHIAP
DEFKALRAKMVETQGIVRQAELSMYSGSSNDLDARRRQELEARLEALQQEYEEVLTRGLG
EADVEEVKARLEAAYAKREKSEAQLVEELKADLAQKASENARMKTLIEELQQRVKTSGTA
STANGKTVQQQIAEFDVMKKSLMRDLQNRCERVVELEISLDETREQYNNVLRSSNNRAQQ
KKMAFLERNLEQLTQVQRQLVEQNSSLKKEVAIAERKLIARNERIQSLESLLQDSQEKMA
TANHKFEVQLASVKERLEAAKAGSTRGLGGAGGGFSFTNAGSRIAKPLRGGGGDAPATPT
IQGGDGTPTGKRGSWFFNKS
Download sequence
Identical sequences G9MTD6
jgi|Trive1|27826|e_gw1.1.858.1 XP_013956560.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]