SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|29093|e_gw1.1.917.1 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|29093|e_gw1.1.917.1
Domain Number 1 Region: 46-202
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-40
Family Ypt/Rab-GAP domain of gyp1p 0.006
Further Details:      
 
Domain Number 2 Region: 177-296
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.04e-25
Family Ypt/Rab-GAP domain of gyp1p 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Trive1|29093|e_gw1.1.917.1
Domain Number - Region: 559-624
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000523
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|29093|e_gw1.1.917.1
Sequence length 778
Sequence
MAKLRKMVRGPTPAALRYSMLPPPPMTDLEFYAALVKDYQQTAARLPTLLSNKIRKGIPP
PLRGVVWQSMSGARDASLEEQYERLNGESSPYEGLIGKDLGRSFPGVEMFRDPDGDGQRM
LGRVLKTFSLYDTKIGYCQGLAFLVGPLLMHMPDKQAFCVLVRLMERYDLRSCFLPDLSG
LHVRIYQFRELLRANLPMLWSHLEDLQVETAYVSQWFLSFFATTCPLPMLFRIYDVVFAE
GASETLMRVALSLMRRNETRLLSCTELEDVMQLLLSRGLWDCYHYNADEFVQDFGSLTST
VTREKLAQLEQGYRESLVATANTARTSDIATAAARFLGRIWASSGAFPRGSGLVPGLSAP
SRPLSMLRRSTSKQSLASTLNSVEASSMSDDSGSRESTPVGPKAAPSTSKNTEDRYLHSQ
IEDLLTALSELQRNHALLSSELKREREERDEDRKAVRSLLDGLRKRASRGDEAAASENED
GADSPTTEEATDNAEEGEKEDEAEKKSDDGSPEAKDAPSAEDLSELLDRVESRFGSEDEN
DNSKKKDKPPSPPLGQRSELQVELDQAKDQLASAMSQNQDFSRRIHDLDQEMSSLKEQLR
ESHSHVRTLHQDKQRLEKQIQVLRARPISGDPVGVRESGVDWTGKANGGSGGGGGGGGGG
LREFKLGRSKSVAAQGATYNRRKSSLLQSNDLSNDSRSSTNDLDTLLLDLVQAKTAQAIA
KQEAEEAKQKLEALKKAYGLPNDSPNAPLPAGSVTVKVAQPAATTTSPGTGGFWGWRR
Download sequence
Identical sequences jgi|Trive1|29093|e_gw1.1.917.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]